Tags

'lil-1st2nd-60s-80874p-9mm-aristocrat-parlor-lantern-cardboard-hot-lightly-new-oakland-srv7061-160-tan-tone0-0250-1000-10100100010000us0-120-2000a0-24600mm0-30'0-30hgv0-500-50000005001mm0011-010r002406-000002740-000006071-000007716r007717r013213-000015-9m017m01torr03-0503-06-03-0903-1205-0905-1205-150513f057332-00005wc06-0906-13060-f827-02065650-000067027-000073-9551-00-058861-00-104501-00-291451-121-131-19741-316-1-141-451-601-716-1-121-731-831-burner1-gallon1-qt10-1110-111410-1310-197310-3010-30010-4010-5010-6710-f12100'100-559-08100-796-00100-mile1000-sq100000btu10000lbf1000m1000w1001a100ft100hz100mm100th100xl101mm102-131105qt105x106k1080p1091596-00-l109rb3610high10in10mm10th10x1010x1210x4211-122011-195411-33x11-5411-871100i1100lbs110amp110v110v1800113k115v118in118x119308-111dikl11x1412''12-1212-1312-1412-1812-34x12-3812-5812-6112-6712-csl12-cup12-gallon12-pack12-piece120-240120-cfm1200'1200-18001200i1200w120a-6120ct120fr120qt120v1230xrl124'125-c125000btu1250w1269e127mm128k12in12long12mile12oo12oz12pc12vdc12x2012x2212x2412x2513-1513-1613-508ll13-508ll-blk13-508ll-dgr13001500series1300cfm1303j7710m1357m135mm135x1139000-btu13gal13pc13qt13x1314-2014-2214-30p14-30r14-33-34714-50r14-s14000-btu140v1410-a1420-a14cux14vintage15''15-3215-36-a15-515-inch15-pack150'1500sq1500w1500with3700150fr1557m155mph15lbs16-10-6461600ef1600m1600mw165ft16ohm17-5817000-btu17ah17x951800's1800-w1800w180p183260-14318183cid1850's18592-351866-'70s1878-19041880s1882-18941890's18gday18hp18k20k18th18x818x8x819-11-860-0119-121900's1905-19231920's-1930's1920's-1940's1920's-30's1920s1928coleman1930's-40's1930-40's1930s1934-19431938-19391940's1940-1947194050s1940s-1950s1940s50's1944'1947-19531948-1949194coleman195-10201950-60's1950s1951-19531951-531954-19621960's1960's-70's1960s-1970's1961-19641961-19651962-'631962-19641962-641969-19741970s19741975-brand1980s1981-19861987-19951990s1991-19951995-19951995-20021997-2006199oz19th19thc1c1801g379l1khz1lng21r-4-241tbd1tdd2-1002-100psi2-2002-792-872-burner2-burnerutensils2-channel2-in-12-pc2-piece2-qt2-way20-inch20-liter20-pack200'200-400200000-btu200000btu2000s2000w2001-20052001-20072001-20102002-20122003-042003-092003-122003-20062003-20092003-20122005-122005-132005-20092005-20122005-20132006-082006-132006-20072006-20082006-20092006-20122006-20132007-20092007-20202007b2008-20132008-2016200a200a275200c200cd200mm2010-132010-20122010-20132010-20162010-20192011-20122011-20152011-20162011-20192012-20132012-20162012-20192012-20222013-182013-20142013-20162013-20172013-20182013-20192013-20212013-20222013-222014-172014-182014-20152014-20172014-20182014-20192014-20202014-20212015-20202015-20212016-20192016-20202016eb2017-20192017-20202017-232018-20212020-20202020-20212020-20222020-20232020-a2021-20232021-23205-32a205-75-14208-240208220v-20ah20amp20mm20mph20ssbon-sd-2020th20wbtu21-inch2121h212b2166-34721mph21tm21x13220-240v2200i220240v220v220volt222105-2222b2258c-01000rv2280sgkac5p34ak296228d22ah22kw22lbs22lr22miles22of22oz22x10522x1422x20x35230-c230000btu230cfm230v23226-523237b23kw24-30224-ga24-gauge24-in24-inch240-c24000-btus240hp240v241x242-2752421secondary2450x2100x1630inch246-2972469e249g24ghz24griddle24hrs24vdc24wx25dx27h24x40mm25-75cps25-cab80s25-epi25-mile25-pdv25-pdvc250-00596-amp250000btu2502-02524k260-c260c2641r25wd11t1c26x2627''27-5827-58x2700-65002740-1275x1528-2928-35002806b2808b281-228mph28x2829''290f2995cc2a-oc0292b6-1b27-140000002day2low2water2way2x-7x2xpremium3-013-19813-20-009993-20-087523-20-093023-20-609063-21-086393-21-290453-21-336473-50-005653-9x40mm3-9x503-axis3-band3-burner3-fuel3-in3-in-13-inch3-pw3-qt3-sides3-speed3-way3-wing30''30-600psi30-in30-inches300'30000-btu30000btu3000w3004-750t300c300p300wm3052c3052d305cid30hz30km30mm30mph30x25x3530x30in31-1231580r225315m315w3200e320ss325-4800329g02832fs32gb32x2833-2446330e33mph33x2033x4634-4834401a34mm34x26x1434x3435-10x4035-10x40mm35-18035-45350-1350350-cfm3500w3502efi350cfm350w35km36-6-1n3676bss36mph36x30in36xl37x125x16538in391a395-4753accessories3d083h42-18c830-ab3pvl-kha3pvm3pvp-wti3pvp-x83rv-wt3speed3vp-36b3x-9x3x-9x404-12x404-12x40mm4-12x504-12x50mm4-16x4-16x50mm4-724-burner4-burners4-channel4-gun4-in4-inch4-input4-level4-minute4-person4-season4-series4-way40-50mile400-499400a400a7017400b400vdc409-8d40lb412-b413-731413-g413d413e413f413g413g499413g704413h413h490j413h499414-700417b42000btu420a424-700g425b425c425c499425e425e499425f425f499425f499t425g426a426b426c426d426d499426e426e499426nl428-70042in42mm433a436l-8438-470438-470mhz44''44-52440w442-710442a445a700445a72045-1445-14x4045-14x40mm45-14x42mm45-14x5045-14x50mm45-30x56mm4520-01-329-3451457g458g45rfe45x14x40mm46''4601dd460dd46dva-cl33p46dva-cl34p46dva-f1246dva-gcl46dva-gk46dva-hc46dva-hsc46dva-kca46dva-tcl47672302-47key48''480-12480i486p-1486p-248c17548ci48x12048x5448x9649-trcpm49cz8524bbl4dt-hc4feet4pvl-e904pvl-kha4pvp-vctb344pvp-wti4rv-184rv-364vp-604vp-904x-12x4x1254x244x5kalart5'x55-205-20x5-50x56mm5-815-door5-level5-pin5-ply5-star50's50-248150-9350-snc1350-tnc1350-tnc3050-tnc3250-trssw0150-trssw0250-trw0350-tvl17500-289500-6000mhz5000cc500a500cfm500m500w501-2891501-700501-800501-9605010a700502-700502-800502-952502a502a741j508-700508a70050bmg50ft50l-v850mi50mm50trvl1751-cu51005-uz512h51in525m52je0752je1153-09653-b530-2995375agn0053mm54-100-024-15409-731540gr5423-7005423e7385423e750545rfe54mm55-280-255-6555-shp1055-shp2255-trp-10-rw55-trp1055-trp2255-trpah55-trpcab8055-trpcb12055-trpep5500m5500xl5501s5502m550b550b725550b74955trp1055trpepi-rw55trpeprw55x51x255660e56mm5700-act5753137cm57st-acc57x35x2858dva-36ff58dva-hc58dva-hsc58dva-snk365a603045feet5gvis5l40e5rv-365sv-bsk10005x656-126-18x406-18x40mm6-19766-24x506-24x50mm6-65-6-8mi6-burner6-in6-inch6-shot6-type600-860000-btu600a600cfm600ft600m600s600w6041hf6041i606-67860hz60mph60s70s610-367617e-126626-668mhz627a62qt640in644jz65-204065-20x4065-20x40mm65-20x5065-20x50mm65rfe66rfe673xz68''68p368rfe6dbk-tl6dp-126dp-kout6dp-kttw6dp-xrb6dt-fcs6dt-stss6dt-tsb6dvl-46ta6dvl-486dvl-kvp6dvl-orad6dvl-t6flew6hole6hp196hp266hs-ta6person6ply6rv-366srsk6st-186st-366t-dsa6t-dsac6t-fsp6t-it6t-rsp6x-24x6x557-147000-0117000-0127000-2067000-885700c700cfm700m70lb7100m711-hs7163-639172000btu7200w720p721n727p7310-01-412-78137310-01-578-641374cb75000btu7503d5750cfm750w754a755a755e75ft75kwh75psi7601p152-607601p154-6077-iv7716-1187716-144776-74242795v7dt-36ss8-168-188-19588-19668-32x508-708-898-inch8-ohms80-fr8000w80010001100i800cfm80211ac802e80472a80600p80mvg80p20001-r80p20003-r80p20296-b-r80p20296-r80p2680p30523b80p30523b-r80p31093-r80p53890-r81012in811-0592812-0051812-0170812-0261812-1080823fz828-658832-1092832-3430832-3520840w842-235084499a85-25x85-25x5085-25x50mm85-5008507p043-6085dt85kwh85mm85x20868w86in87-120017-001870cfm8800mah89-568-189-94891297-amp8hs-rks8ohm8pcs8t-dsa8t-fsp8t-rbk8t-sb8x109-19569-19649-40900cfm900m900sq931cb931mm9327-059327-079327-099327-11940nm940ntntek00000945a948rl95-0296-02975a98db99-0299-0799-1899-5202-00049984-7539a-1000033989x139x45x25a-40a-47a-e-033a-e-033-aa-e-033aa-e-301a-vs100a0500a11113a122a122baa14015a14020a1769001204a47'sa4aka50400a50403a741a80102a99526aac17-22g4aac191122sabandonedaberdeenabsoluteabsolute43absorberabsorptiveac-3000ac1536academyacamparaccelerometeraccentaccentraacceptedacceptnaccessaccessoriesaccessoriesbrookfieldaccessoryacclaim'accuaccu-rangeaccu-shotaccu-tracaccubakeaccublockaccumulatoraccuracyacdcachp-4acmeacousticacr4303mfs7acresacrylicactionactiveactuatoracumenacw11ad-1adamsadaptationsadapteradd-onadditionaladhesiveadjustadjustableadjustedadmiraladobeadthadultadultsadvanceadvancedadvantageadventureadventuresadvertisingadviaceaep222vaw1af-seriesaffordaffortableafmdfmaftermarketaftonag-13ag13againagc500vfbagdv8lagedagencyagendaagi-fuelagilentagitatoragm73551624-agmcoagnesagreesagricultureah22-18c815-adah42-10e887-aeah42-10e887-mbah42-10e887-mdaheadaircraftaireairjetairotronicsairportairstoveairstreamairtempairtightajaxakronalabamaaladdinalarmalarmsalaskaalaskanalbanyalbertalcazaralchoholalcoholalcoholelectricaldialertalicealiminumall-cladalladinalleghenyallenallergiesalliancealliealliedalloyalmostalnicoalonealotalpairalphaalpinealpineraltecaltecwealternatealternativealternativesalternatoraltoalumaluminiumaluminumalx1-am-4477amaizablazeamalgamatoramanaamarilloamazablazeamazingambidextrousamericaamericanamerican-builtamericanaamericansamherstamigoamishammeterammoammunitionamnesiaamountamp-b47120amp-ccm-kitamp-univcombamp-univcombkitampereamperesampexamplifierampsamscoanalogueanchorancientandcoandersonandroidangelesanimalsannexannieanniversaryanotheranpvs-30anr4353ansulansweredantarticaantennaantennasantianti-corrosionantiguaantigueantiqueantique-cookingantique-superlectricantiquesantiquevintageantonioantqueanvilanvil-spindleanythingap130ap2125858ap5178660ap5501sap56ap5660lap5710ap5710map60apartapartmentapexapogeeapolloappalachianappalachiantrailappearanceappearsappleapplianceappliancesapprovedapproxapricotaprilapronaps1100baquaaqua-thermaquaceraaquariusar-5ar-6ar30-4bar36g-4bar424ar500ar600araharcadearchedarchersarchery-architectarchitecturalardmoreareaarg25arh23ariaariannitaaristocratarkansasarmadaarmamentarmasightarmedarmorarmorsteelarmourcasearmsarmstrongarmyarmyusmcarnottaromatherapyarr636narrangedarrayarrestsarrivalsarrob430narrob636narrowartemisartisticartsas-isasburyparkashcroftashevilleashlandashleyashtrayaskedasmraspenassembleassembledassemblingassemblyassistassistedassyastonishastoriaasv7652xasymetricalathensatlantaatlanticatlantic-aatlasato-6b24gatomicatosaattachmentattachmentniceattachmentsattackattackedatticatwoodauburnaudibelaudioaudiophileauditoriumaugeraugerfanaurusaustonaustraliaaustroaustroflammauthenticautoauto-ignitionauto-light-auto-trackingautoclaveautomatedautomaticautorangeauxiliaryav790blavailavailableavalonavalon1250iavantiavcoilaventaviationavocadoavoidaw100eaw180aw180blaw740awardawc21mawesomeawr1166lnfax364axisazimuthazzotab-46b-47b-81b-pillarsb0864vtj3kb1-104b111b14018b15004b1x-s48ss-ulb2350b2941b40575b40606b40717b41517babybackbackcountrybackdatedbackedbackpackbackpackerbackpackingbackpackingmountaineeringbacksplashbackupbackyardbacteriabadgebadgerbadlybafflebajabakebakerbakersbakingbalcsbaldwinbaleballballisticbalscopebandband-a-blubangorbankbanningbansbaofengbaratronbarbecuebarbequebarbiebarcodebarelybargainbarksdalebarlerbarler'sbarnbarnesbarrbarrelbarridonbartbartonbarzsobasebaseblowerbasecampbasementbasetarpbasebasicbasketbassbasscarvinbatmanbatteriesbatterybattlebattle-marvel-1969-vgbauschbaxterbayfrontbaylinerbaywinbazookabbn1303bc-acbcacbcsd136bcsek130beadlockbeambeanbearbearingbearpawbeastbeaterbeautifulbeautifullybeautybec95ebecamebeckwithbecmbecomebeefbeehivebeenbeer-drinkbeginnerbeginnersbeginsbegunbeigebelairebeldingbelievebellbellabellairebellebellybeltbementbenchbenchrestbendbenefitsbengalbenitoberenicebergstrumberniebernzbernzomaticbespokebestbetterbettinabeveridgebeverlybewarebezelbfgoodrichbh32-19g525-dfbh42-10e887-mbbh42-10e887-mdbiampbicyclebidenbiflexbiggestbigsbybikebillbillheadsbillsbilsteinbiltbinderbinghamtonbinobinocularsbinox-hdbiofuelbiolitebiomassbirdbirminghambirthdaybiscuitbishopbisquebistrobitcoinbitterbjwabjwa44tc1248bk-accbk804bkad500blackblack-1black-on-stainlessblackbearblackblueblackcyberwhiteblackhawkblackredblacksilverblacksmith-freeblacksmithingblackwaterbladderbladeblamesblanketblastblazeblazerblendblewblindblizzardblockblockerblockingblocksblondeblowdownblowerblower-4500blowersbluebluegrassbluestarbluetoothblymerbm0111bm0113bmpsbnibboardboatboatsbodybodypackboggisboilboilerboilsboisboltbonamibondbonebonfirebonusbookbookendsbookletbooksboonbooneboostboostedboosterboostersbootbootsbordeauxborderboreboringbornboscaboschbossbostonbottlebottlesbottombottomlineboughtbowlbowlsbowmanbowmannbox-boxedboxesboxingboxmanualboxwoodboysbp60001-6000wbracebracketbracketsbradybraidedbrainbrakebrakesbrandbrandedbrandsbrassbrazierbreadbreakbreak-apartbreakerbreakfastbreakingbreathingbreckwellbreechbremerbrickbricksbridgebriefcasebrightestbrimbrinkbritainbritishbroanbrochure-broilbroilerbroncobronxbronzebrooklynbrooksbrosbrothbrothersbrownbruncobrunnervillebrunswickbrushbrushedbrushlessbryantbsk1000bsk2000bsr-bsrbirminghambsrcastbt13-qkbtuhourbtuhrbtusbuckbuck'sbuckeyebuckinghambuckstovebuddyflexbudgetbuffalobuffetbuildbuildingbuiltbuilt-inbulbbulbsbulkbulldogbulletbulletproofbullseyebumperbumpersbunchbundlebungalowburgundyburiedburingburnburnedburnerburnerboilerfurnacestoveburnersburners-stainlessburnersgriddleburningburnpotburnsburnsideburrisburtonbushbushcraftbusinessbussbusseybutanebuttercupbuttonbuyerbuyingbws45bx26ebypassbyrdc-d-2700-ampc-e-010c-e-301c-modelc-sps-2-18c04b32018c1886c1908c1920c1948-1954c223c242c24s-4bnc31-h2c312c60471c836-6c836-9cabincabinetcabinetscabinscablecaboosecaddycadetcafecagecaguama'scakecalculatorcaldwellcalfcalibratedcalifcaliforniacalipercallcallscaloriccameocameracamilliacamocamouflagecampcamp-stovecampaigncampanioncampcanningdisplaycampcookcampercamperscampfirecampgroundcampincampingcampingbackpackingcampingemergencycampinghikingcampingsurvivalcampmatecamprvcampstovecampwoodcamshaftcan-amcanadacanadiancandycanistercanisterscannercanningcannoncannon-battlecannonscanteencanteenshopcanvascapablecapacitycapecapitalscapscapsulecapturedcapturescaravancarbcarbidecarboncardcargocaribbeancariboucarlincarloscarlsoncarmarinepowersportscarmarinepwrsportscarnitascarnivorecarolinacarpetcarriercarrotcarrycarryingcarscartcartoncartridgecarvedcarvercascadecasecasehandlecaseinstructionscasepotscasescaseshootingcashcashcocasocassettecastcast-ironcasterscastilecastingcastingscastings'resolutecastings'vigilant'castironcastlecastletoncat-backcataliticcatalogcatalystcatalyticcatchcatecathedralcatskillcattlecausecavalrycavecavitycawleycawley-lemay-wood-burning-stove-with-woodland-detailing-model-600cawleylemaycazocb-36cb1200cb36cb547cc-001cc-005cc-100cc-111cc-255cc-405cc-453cc-505cc-520cc-526cc-601cc-604cch-milcclbccs14ccs18ccsbce010cecilwareceilingcelebratingcellcellocellscementcemicentcentennialcentercenterrangeovencentralcentriccenturycerametixceramiccertcertaincertifedcertifiedcessnacf6n-18c815-jdcf6n-18c815-jpcf700mchabbychainschairschalainechallengechamberchamberschameleonchampionchancechangechangerchangingchannelchapschar-broilercharbroilercharbroilergriddlecharcoalchargechargedchargercharitycharlescharmchaserschassischatchateauchattanoogacheapcheckcheckedcheesecheesemelterchefchef'schemicalchemworldchennaicherfiluscherrychesapeakechevroletchevycheyennechicchicagochickenchiefchikumbutsochildchildrenchildrenschildschillchillychimneychimney-stylechimneyschinachinesechinkschipchippingchocolatechoicechokechrischromechromedchryslerchubbychuckchuckboxci1500dvfci1504dvfci2504dvfci2508dvfcicib2cigarcilivingcimarroncincinnaticinnamoncircacirca1959circlecircuitcircularcirculatedculls-circulateurcirculatorcirculatorscirculatorycitycivilck-2000ck10ck117cl8187cla-classclaimsclampclarionclarkclassclass-aclassesclassicclawclawsclayclaytoncleancleanedcleanercleaningcleanoutcleanpairclearclearanceclearstreamclevelandclimateclimbedclimbingclipclipperclockclockwiseclonecloseclose-upcloselycloserclosetcloverclubclustercm100cntlco-axialco-linearco-mtco-opcoalcoal-onecoal-onlycoalfirecoalwoodcoalwoodgascoastercoatcoaxcoaxialcobracocinacocoacodecoffeecoilcoincoinscokecoldcoldstreamcolecoleamncolemancolemencollagencollapsablecollapsecollapsiblecollapsingcollarcollectablecollectiblecollectiblescollectioncollectorcollectorscolletcolmancolonialcolorcoloradocolorscoltcolumbuscombatantcombinationcombocombustercombustioncombustionrocketcombustorcomercialcomescomfortcomfortbiltcomicscomingcommandcommandercommemorativecommercialcommitteecommoncommunitycommutercommutingcompactcompancompaniescompanioncompanycomparatorcomparingcomparisoncompasscompatiblecompensatorcompletecompletelycompliantcomponentscompressioncompressorcomputerconcentricconcentrusconcernsconcessionconcordeconcretecondcondarcondarcc-257conditionconditioningconductivityconeconesconestogaconfectioneryconferenceconfigurationconflictconfrontsconnconnectedconnectionconnectorconnorconsconservoconsiderconsoleconsolidationconstant-dutyconstitutionconsulateconsumercontactlesscontainedcontainercontempocontinentalcontinuescontrolcontrolcircuitcontrollercontrollerscontrolsconvconvectionconvenientconventionalconversionconvertconverterconvertibleconwaycookcookercookerscookiecookingcookscookstovecooktekcooktopcooktoprangecooktopscookwarecookware-stove-oven-tablecoolcooler-coolingcoopcopingcoppercopycorcocordcorecoricorncornercornflowercorningcornpelletcornuecoronadocorpcorpscorreacorrugatedcortezcortlandcosmeticcostcostcocostingcotronicscottoncoturnixcougarcouldcouldncouncilcountcountercountertopcountriescountrycountrysidecountycouplecovenantcovercover-griddlecover-noodlecover-stovecoveragecoverbondcoverkingcoverlaycoverscovertcovidcowboycowboyscowhidecowscoyotecozycpsncr2110cr41crackedcrackingcrackscraftcraftedcraftsmancranecrankscrawfordcreamcreamycreativecreedmoorcreekcreo-shotcreosotecreosotesootcrescentcretecreusetcrewscricketcriditpidcrimpcrisiscrispycriticalcrockcrockettcroixcrosleycrosmancrosscrossfirecrossflowcrossingcrossovercrowdfundingcrowncrucialcruisecrumblescryecrystalscs-100cs-257cs-526cs-604cs0531csdv30ct-aaacu-047042cu047042cubiccue-grillcuisinartcuisinecullcumarucumberlandcumminscunifecupboardcupscurlingcurrentcurrentlycurtcurtaincurvedcushmancustomcustom-deluxecustomercustomextended-rangeebonyneck-thruactive-eqfantasticcustomizecutawaycutecutscuttscv616cvgx2423bcybercycleworkscylinderd-30d01b45067d123d208d20ed216da-7031-153-9dacordaguerreotypedailydairydamagedamageddamndamperdampersdanadanbydangerousdangersdanieldanleydansondanvilledarkdarthdashdashboarddashclockdatedateddated1952datesdaughterdauntlessdaviddavidsondaysdaytondcf894bde81-08448ade81-09179ade92-03960c-deaddealdealerdealingdealsdeandeathdecaldecalsdecemberdecentdeckdeclareddecodecordecorationdecorativedeepdeepwelldeerdefelskodefenderdefensedefiantdefinedegreaserdegreedegreesdehydratordejurdelaysdeliciousdeliverdelivereddeliverydeltadeluxedemodemo-2014democratsdemonstrationdemorefurbisheddenimdensitydensodentdentaldenteddepartdepressiondeptdepthdercodescdescriptiondesertdesigndesigneddesigningdesignsdeskdestinationdetachabledetachmentdetaileddetailsdetectiondetectodetectordetectoresdetentdetroitdevicedevildevilledewaltdexrondexterdf364-gdf364cdf364c-lpdf366df484-cgdf486-gdf486gdfi2309dfr7dg94-00071adg94-00215edg94-04293adg97-00074ddiablodiagnosticsdialdial-a-dialsdiameterdiamonddiamondsdidndie-cutdiegodieseldieselgasdietdiffdifferencedifferentialdigitdigitaldigitalfitdigitallydimensionsdimmerdimplexdirectdirect-readingdirect-tempdirectiondirectionaldirectventdirtdirtydisablerdisappointingdiscdisc'87-120016-001discountdiscouragediscoverdiscoverydishwasherdiskdisplaydisruptiondistancedistillingdistributiondistributordistrictdiverdividerdivisiondixiedl-220dm2dxa4xb2xdnns036dockashdocumentarydodgedoesndoingdolandolldollardollarsdollhousedolly'sdolphindomedomeddomesticdominantdominiondonedontdoordoors-dosimeterdoskodotsdoubledouble-doordouble-walldoublerdowagiacdowndraftdownwarddr55dracodraftdragondrawerdreamdreamerdressdressingdrierdripdriplesdriplessdrivedriverdriversdrivingdroletdronedropdrop-indropoffdroughtdrumdryerdsp6tldtl-100idualdual-fuelducatiduckducteddudleyduelduelingduettaduluthdumbestdumpdungareedunlopduplexduplicatedduradura-ventdurabilitydurablackduraflameduraflexduramaxdurangoduraplusduratechduraventdurozonedutchdutchwestdutydv30bdvagdvp30ca30dwyerdynamicdynamicsdynamitedynastydyniscodytrane-1310e-scootere03b01052e40513e53469eagleear-earlearlyearmuffsearthearthquakeeasiereasteasterneastoneasyeatingebikeebr79332513ec-cclbeccoeclipseecmwfeco-oneecoaireecochoiceeconoeconomiceconomicaleconomisteconomyecozoomecsbecwsecwted53-uledgeedgeseditionedtneducatoredwardianef-9ef-901ef3800ef86effecteffectsefficiencyefficiency-topefficientefficientlyeffluentefireplacestoreeggsek2000ektarelbowelbowselectionelectricelectric-coal-woodelectriccooktopelectricgeelectricityelectricnewelectricselectroelectro-oxidizedelectro-techelectro-voiceelectrochefelectroluxelectromaticselectronicelectronicselectroscopeelectroscopeselectrostaticelegantelementelephantelginelimeliminatoreliteelitedealselkhartelliselmiraemberemberlitemblemembossedembrembroideredemeneeemergencyemf-1eminenceemissionsempavaemperorempireemployeeemptyemrichenamelenameledenamelwareencastrableenclosedenclosuresencoreencryptedendeavorendersendplateendsenergyenerzoneengineengineeringenglenglandenglanderenglander'senglandsenglishengrengravedenhancerenteredenterprisesentertainmententranceenvelopesenviroenvirofireenvirofitenvoqueep-10ep62-1epa-certifiedepa1000epd1epicepisodeepisodesequipedequipmentequivalenter36der36dschnger36gschlpergolitecurvederieeriezerraticerrorsesbitescaladeescapeescortesseessexestateestimatorestufaestufasesw0031et-300ethicsetl155000btuetl227000btuev-10ev10evacuateeventsevereverdureveresteverhoteverneweveryevolutionevoqueevzeroew300g3ewingexactexampleexcellenceexcellentexcelsiorexceptionexceptionalexceptionallyexchangerexcitingexclntexcludedexclusiveexctexemptionexerciseexhaustexistingexodusexothermicexpandexpandedexpanderexpansionexpeditionexpeditionaryexpensiveexperienceexperiencingexperimentalexplainedexplodingexplorerexploringexplosionexponentexposedexquisitelyextendedextended-rangeextenderextendsextensionexteriorexternalitiesextraextractorextrasextremeextremelyexwayeyedisceyesf-typef100f1000f100gf1100f120f600500f722fa224aclfabricationfabricationsfabulousfacefaceplatefacesfactfactoryfactory-refurbishedfadefieldfahrneyfailfairfairbanksfairchildfairmountfairwayfalconfallsfamiliesfamilyfamousfan12003fancyfantasticfarmfarmerfarmersfarmhousefarmyardfashionedfasnsealfastfastestfastgunfatesfatsofaultfavoritefc90fce119wfdryfdv350fdv451fearfeatherfeathersfeaturefeaturesfedderlyfederalfedsfeedfeederfeedingfeedsfeelfeesfeetfeltfencefenderfentonferradaffed3025pwffef3054tbtfgif3036tffiberfiberboardfiberglassfibrefieldfiestafighterfigurefiguresfilmfilterfiltersfinalfinallyfindfind-r-scopefinderfinder-press-photojournalismfindingfindlayfindsfinefingertipsfinial-finickyfinishfinishedfinlandfirefire-boxfirebackfirebowlfireboxfirebrickfiredfirehikingfirehoodfiremakersfirenestfirepitfireplacefireplace1965-1970fireplaceboxfireplacesfirepotfiresfirestarterfirestonefireviewfirewoodfiringfirstfishfisherfishingfitsfittedfitzgeraldfitzwilliamfivefixesfixingfixturefj40fk26flagflag-lockflairflakflameflamesflamethrowerflannelflapflashflashingflashlightflashlightsflatflat-topflatpackflattopflatwareflawlessflawsfleetwoodflemingflewflexflexburnflexfuelflexibleflexshaftflinsonflipflippingflirflirtfloodfloorfloorlinerfloorlinersfloorsfloorstandingflopflorencefloridaflowflowersfluefluelessflukefluoridefly-barflyingfoamfocalfocusfoggerfoilfoldfoldablefoldawayfoldingfollowupfondafontfoodfootfootedfootpadfor130forcedforcesfordforedomforeignforestforesterforeverforgeforgedforgiatoforgottenforksformaldehydeformatformingformulafosgatefosterfostersfostexfoughtfoundfoundationfoundryfountfourfowardfowlerfozgometerfpgf3081kfframeframedframingfranciscanfrancofortefrankensteinfranklinfranklinitefraryfreefree-rangefree-standingfreeshipfreeshippingfreestandfreestandingfreezefreezingfreightfremontfrenchfrequenciesfrequencyfreshfreshlyfretlessfridayfridgefrieghtfrigidairefrigidairedoublefrigofringefrogfrontfrontierfrskyfrugalfrugallivingfryerfryersfryingfs17wb4a-blfsre17sa-blfsre17sa-ssfsre21sa-blfsre21sa-ssfsvl3604ft24n62r-ssft37ftrssfuelfuel-savingfueledfuelingfuelsfullfull-rangefullerfullfieldfullyfunctionfunctionalfunnelfurnacefurnace-120000btufurnacesfurniturefurrionfurtickfusefuturefuzzfyreknightfyresergeantfyrestormg-60g3-gga3640gaetzgaffersgafflersgagegaingallongallonsgalvgalvanizedgamblesgamegamesgamesstagesgaminggaragegardcogardengardnergarlandgarlandusgarmingarrettgarrisongas-on-gasgasifiergasketgasketsgasolinegasonegategatesgaugegb40-1gci60gcrg3060afbgeargearboxgen1-3gen2gen3gen4generalgeneratinggenerationgeneratorgeneratorcasegenesisgeniegeniunegensgentlygenuinegenuineoemgeolocatorgeologicalgeoorbitalgeorgegeorgetowngerbergermangermaniumgermergetsgettinggf55-912gf55gfi55ghostgiantgiftgiftsgigabitgilbertgimbalgimbaledgirlgivegivinggladiatorglampingglampingstoveglassglasstopglenwoodglideglimpseglo-boyglo-fireglobalglobeglockglofglogaugloryglossglowglowboygnomegoatgogogogohmanngoinggoldgoldbondgoldengoldsilvergolfgolitegonexgonggongsgongs-steelgoodgooglegoosegoprogordongorgeousgosungosun'sgotraxgourmetgovernmentsgowdygr30gr304gr304-lpgr36gr48gr484cg-lpgr486-cgr486ggr60gra58gradegradsgraduationgraflexgrahamgraingrammargrampagrandgrandmagrandpagrangergranulegrapevinegraphicgraphitegrapho-glasgrassgrassesgrategratesgravitygraygrayblackgraysongreasegreatgreatestgreatlygreengreenfiregreenfistgreenhousegreenlandgretschgreygreystonegridgriddlegriddlegasgrillgrillegrillevatorgrillhibachigrillinggrillsgrillstovegrilltopgringagripgriswoldgrittygrizzlygromgroovedgroundgroupgrovegrowgrowthgstovegt0140sguaranteeguaranteedguardguardianguardsguestguideguidedguitargun-hogunsgunsmithgustsgutfeldgw1949gw2014wgx10gyz43h-33h-45h2n2h4p3-9g774-ach7881haashadleyhageehailhairhalehalfhalf-outhalloweenhalohamashamburghamburgerhamiltonhammerhammeredhammeringhamptonhamrhandhand-heldhandbookhandcraftedhandedhandgunhandheldhandlehandlefthandleshandmadehandyhangerhanginghankshansonhappeninghappenshapperhappinesshappyharborhardhardenedhardwarehardwickhardwirehardwoodharkenharleyharmanharmonharthartleyharvestharvesterharvestersharvestinghastingshatchinghaulhaulerhavehavenhawkenhazelhazletthazyhcr41headheaderheadlightheadlightsheadphonesheadrestheadsethealthhearingheartbreakinghearthhearthmounthearthstoneheartlandheartwoodheatheat-englanderheatedheaterheater-sunlightheaterlampstoveheaterparlorheaterrusticheatersheaterstoveheatfabheatilatorheatingheatmasterheatsheavyhebardheeleyheinzheiroheldhellhelmethelphemmedhemphempohempopotamusherbherbicideherculeshereherefordheritagehewlett-packardhexaminehf60hi-lohibachihickoryhidehideouthidinghighhigh-efficiencyhigh-outputhigh-powerhigh-resolutionhighwayhikehikinghillhillerangehillshimalayanhingehingedhiorucethistoryhitchhitshittinghitzerhj32-14c239-hahmmwvhobarthobbithockinghoganhogorholbrookholdholderholdsholeholidayhollandhollisterhollyhollywoodholyokehomcomforthomehomelesshomelessnesshomemadehomeshomesteadhomesteaderhomesteadershomesteadinghomestrandhomewoodhonehonesthoneywellhoninghoochhoodhood-madehoodshookhopehopperhopscohorizontalhornhornillashorsehorseshorynarhosehospitalhotblasthotelhotplatehotpointhoundhourhourshousehouseholdhouseshouseshophousinghowehoythp42hp50-nowhpi4-2600hr-8hr91chsesesvrhshmhubleyhudsonhuenefeldhugehulkhumbuckerhumbuckershumidifierhummerhumphreyhumveehundredshungarianhunthunterhuntershuntinghuntshuntsmanhurlockhurricanehutchhvachvacrepairguyhvbathws-224172mhhy-chybridhybridshydraulichyperhyperflamehypermotardhzb10020-100-gi1000i1100i2400ice-fishingiceboxicefieldiconicideaidealidhp-36idpaidpaispcidrg-6idryfireifst-25igniterignitingignitionignitorii-tikonillegalillinoisilluminatedilw16imageimagingimarksmanimmaculateimmediatelyimmersionimpactimpeachimperialimportimposedimpressionsimprovedimprovementsimproverin-lbin-linein-r100in-storeinchinch-browninchesinclincludeincludedincludesincluedinconlincreaseincreasingincredibleindependenceindependentindiaindianindianaindicatorindigoindividualindoorindooroutdoorindoorsinductinductionindustrialindustriesindvrbdsbinfernoinflationinfoinfomercialinformationinfra-redinfraredinfrastructureingramswaterandairinhumansinitialinjectorinjectorsinlaidinletinlineinnerinnovativeinsaneinsertinsertsinsiderinspectorinspiredinstinstallinstallationinstalledinstallinginstantinstant-liteinstastartinsteadinstoveinstrucinstructionalinstructionsinstrumentinstrumentsinsulinsulatedinsulationinsuranceinsurrectionintakeintegraintelintelligenceinterfaceinteriminteriorinterlockinternalinternationalinternationaleintgintrepidintrepid-iiintroductioninvensysinventionsinverterinvestigateinvestigatesinvestmentinvestmentsinvoiceio-wrpionizingior-valdadaiotaiowaipc-14iphoneipsciq00354ir-10ir-4ir-6ir-6-cir-6-eiradariraniridiumirlaserironiron'sironstrikeirs00islandisleisraelissueissuedissuesitalainitalyitemitemsitouchlessixldpj1000j245005htjackjacketjacksonjacksonvillejad8004jadejadeitejaditejaguarjamesjamestownjanejanuaryjapanjapanesejarsjavajavakitjawsjbp26b0j2rbjds9861aapjea7000adbjea7000adbajeansjeepjennjenn-airjennairjennerjenningsjensenjerseyjervisjessejetbjetboiljeweljewelljewelsjewett-woodjewishjewsjf50sjgp3030sl1ssjgp3036slssjgp328bec1bbjgp963sek2ssjhc4jiffykookjitsujj32-2c405-adjoeljohnjohnsonjointjonesjosephjotuljourneyjtuljuanjudaismjudgejudgmentaljudiciaryjudyjugsjulyjumbojunctionjunejuniorjunkjustjusticekababkahlerkahnkalamazookalartkampkampkookkansaskaowoolkaratekarenkarlsoffthegridkatahdinkatydidkazankdrs463vsskeefekeeokeepkeepingkeh3gxakeithkellykelseykelvinatorkenmorekennametalkentkentonkenwoodkenyonkeptkernankerneratorkerokerosenekeroseneoilkerosinekestrelketoketonkettlekettleskeyskeystokerkeystonekgcs166gss2khankickkickstarterkiddekidskifarukillerkillingkilokilo3000bdxkingkingcampkingsmankinleykit-kit-30ftkit-domestickitchenkitchenaidkitchenettekitskl-2kleenklinkerkingpelletkn615-hckneeknewkni-coknifeknightknightsknivesknobknobsknowknoxkoblenzkodakkodiakkookkooklitekoreankowakozikozykp130kr32svs1b076mks5020-1040ksgg700ess1ksh120kst-4kt570kttwkumakxpd2l-3382l-3383l01b49026l320l322l405l494l560la-325la325labellabslacknerladiesladylady'slakesidelakewoodlambertlaminatelaminatedlamplampminilampslancasterlancerlandland-roverlanderlanderslandislandroverlandscapelansinglanternlanternslanternstovelapualarglargelargegolflargestlaserlaserammolaserradarlasrlastlatchlatelaterlatestlathelatigolatinlauncherlaundrylaurellauretlavalayeredlayoffslbt-8030alcs-2ldm50ldr-rr-8aldr-rs-13ble5-10le550iqle8-1le8tle8t-hleadleadedleaderleadsleafleafsleakedlearnlearningleatherleavenworthlebanonlectureledlampledsleftlegallegendlegendaryleggedlegslegstowellehighlehmanleisurelemaylengthlennoxlensleodlesslessonlethalletsletterletterheadletterheadslettersleupleupoleupoldlevellevelinglevi'slevitonlexingtonleyseleysilgef3043kfnlghtlh'93-95liberatorlibertylibrelid-all-in-onelidarlidsliedlifeliftlifterlightlightinglightslightseekerlightweightlimitlimitedlimiterlimitinglincolnlindberglinelinearlinedlinerlinergalvlineslininglinklinkslinksyslionelliquidlislelistlistedliteliterlithlitholithographiclititzlittlelittonliveliveslivestocklivinglixadalm2000aln-25loadloaderloadingloadslobbylocallocatorlocklockablelockedlockinglockslockwood'slocomotivelodgelogmasterlogslogwoodlok-griplomblomglondonlonelonglong-rangelongboardlongerlooklookslopiloselothloudloudspeakerloudspeakerslouislovelovedlovelessloverlovinglow-midlow-profilelow300lowerloweringlowmanlr023964lr032560lr07906lr079069lr079611lr079612lr092461lr113583lr114004-45008lr2940replr3lr4rangelrdglrr-104lrrplrskel30twls-12lsr-28plt-aaaltf12ic2ldqplti-2020lucasluccheselumberlumberjackslumenslunalunenburgluxeluxurylvinglws-130291lymanlytem-185m-1937m-1941m-1942m-1942-modm-1944m-1945m-1950m-23010m-78m-sizedm135-10x40mmm1941m1942m1942-modm1942modm1944m1950m2000m201-m511m240m3000m3500m36980m400m4000m4300m500m6ltm965m998mab41machinemachinistmademade1962-64madisonmaestromafsmagazinemagazinesmagicmagisticmagmamagnaflowmagnalitemagnecormagnepanmagneplanarmagnetmagneticmagnetsmagnificationmagnoliamagnummagsmahoganymahogoneymahrmailmail-inmailboxmailbox-readingmainmainemainlandmaintenancemajesticmajolicamakemakermakersmakerthomasmakesmakeupmakingmalemalleablemalmmalvenmamamambamanagementmandrelmangalmanifoldmanilamanitobamanningmanometermansmansfieldmansionmantelmantlmantlemanumanualmanualsmanuelmanufacturedmanufacturermanufacturingmaplemarblemarcmarchmarch-brownbackmarcianomarinemarinecampmarinermarionmarkmarkaudiomarkedmarkermarketmarksmarksmanshipmarquismarshallmarsocmartenmartialmartinmarvelmarvelsmashmaskmasonrymassmassachusettsmassiemassivemastermatalmatchmatchedmatchingmatchlessmaterialsmathewmaticmatrixmatsmattmattematthewsmaverickmax-drawmax360cmaximizemaxipromaxpeditionmaxwellmayfairmayormaytagmazzantimbuv3mc14004-200mc1800mc3300xmc330l-ge4eg4namc82mccauleymccormickmcdavidmckeemcleodmcmillanmcp-12nme72mealmealsmeasmeasurementsmeasuresmeatmeatermeater165ftmechanicalmechanismmechatronicmed-2xlmedalmedeocremediamedicalmedicaldentalmedicinalmeditationmediterraneanmediummee61841401meecosmegamegamagmembermemorialmemsmensmercedes-benzmerconmercruisermeriammeridianmerrillmerrittmerritt'eldorado'mesameshmeshesmessmessersmithmetalmetalesmetalsmetalworksmetermetrosmetsmexicomeyermg-125amg-iiiamh-6rmh80120asmi-6234micamichmichaelmichelinmichiganmicromicrofibermicrometermicronmicrophonemicrowavemid-centurymid-frequencymid-latemid-rangemid-sizemiddlemidgetmigalimightmightylitemil-dotmil-specmilagemildotmilemilesmileseeymilestonemilitarymilkmillermillingmillionmillivoltmillsmiltarymilwaukeemindminerminimini-circuitsminiatureminiaturesminigonminimalminnesotamintmintsmintyminuteminutemanminutesmiraclemirrormiscmisenomisermissmissabemissilemissilesmissingmistakesmixedmixerml-sizedmla3mm-4mobilemoblemochamodamodemodelmodelsmodennairemodernmodernizedmodificationsmodinemodsmodularmodulemodulesmogulmojavemollemom'smomanmonarcmonarchmondaymonessenmoneymonitormonitoringmonkmonoblockmonocularmonogrammonopodmonstermontagemontaguemontanamonterymontestudiosmontgomerymonthmonthsmonticellomontrealmoore'smoosemoparmoremorganmormonmortarmossmostmostlymotherloadmotifmotionmotormotorcyclemotorhomemotorolamotorsmotorsportmountmountablemountainmountaineermountainsmountainskimountainsmithmountedmountingmountsmovemovesmoviemovingmp909e1372mr994ams28ms2hpmu-mimomuchmudfordmujimulemulliganmultimulti-directimulti-fuelmulti-functionmulti-namesmulti-rangemulti-technologymulticammulticladmultifuelmultimetermultiplemultivoltagemunroemunroesmurderermurphymusemuseummushroommustmustardmyersmylesmyronmyshiremysteriousmysteryn-10-bn-41na-macnamenameplatenannienannynanonanometersnapoleonnasanash-kelvinatornashuanationalnationsnatonaturalnaturalpropanenaturehikenavalnavigationnavigationalnavynavysealsnderne63bb871112-aa-00nebulanecknecklaceneedneededneedsneoceramneonnesconestsnetworkneutralnevernewdoblenewernewfoundlandnewfreenewithnewithcompletenewlynewmacnewmannewsnfp-2ngcd6nglpnglpgnicenice1niceeeenichenickelnickel'sunshinenickel-platednickelworksnicklenightnight-brassnighternightmarenightmaresnikeninebotnk30cb600wcgaank36cb700wcgaanoisenom-38075non-ammoniatednon-butylnon-catalyticnon-catalyticcatalyticnon-ductednon-electricnon-sticknoncatalyticnoodlenorcrossnorgenormalnorthnorthernnorthwesternnostalgicnotchnotesnottinghamnovanovelnoveltynovynozzlenp203np205npi45nps45nspronu-waynuclearnuflonumbernumertapnutrientsnutsnuwaynylono'keepeoakleyob01613obadiahobjectiveobsoleteobstructoccidentaloceansoctoberoculusodf2000offensiveofferoffersofficeofficersofficialofficiallyofficialsoffroadoffsetogeryohioohmiteohmsohuhuoiledokeefeolatheolderoldsmobileoledoliveoliviaolson'solympicombrรฉomniaonceone-burneronesonewheelonewheelxronionsonlyonoffonyxoo9327oodlesopenopenedopeningoperableoperateoperatingoperationoptaropticsoptimaoptimaloptimumoptimusoptimystoptionoptionaloptionsorangeorderordnanceoregonorganicorganizeorganizerorginalorientationorigorigilnaoriginaloriginal'70soriginalsorignalorigoorioleornamentalornateorphanosblvosbornosburnosc-mt-mp01oscillatorothellootherothersoupesoutbackoutbackeroutdooroutdoorsoutdoors-manouteroutfitoutfitteroutlawoutletoutputoutputextendedoutsovaloval-to-roundovationovenovenaccessoriesovenbroilerovenetteovenmodelovenrangeovensovens-rareovenstoveoverbagoverdriveoverhauloverheadoverlandingoverlayovershelfoversizedoverviewowensownerownersowningownrowossooxdv30nvoxfordoxideoy2p303a0135ozarkp-38p1683p2000fsp2000ip226p228p229p23fsp24fsp25analogmixedp2700p320p35ip38ap4000p4821p4823p525p52frp61ap760p7677p9117-pvpa020035pa020041pa020042pa020047pacesetterpachmayerpachmayrpacificpackpackagepacketpackspad-paddlepaddlespadspagepagerpagerspaintpaintballpaintedpainterpaintingpainting'sanpairpalletpancasepanelpanelspanicpaniopanisciapanoramicpanspantherspantinpantrypantspapapaperpaperspaperweightpaperworkparaparabolicparaffinparamountparatarpparentiparisparkparkaparkerparksvilleparlecparlorparlourparmakparrillasparst-3b26w-lpartpartnerpartspartsaspartypassengerpassivepastapastorpasture-raisepatentpathfinderpatiopatrickpatriotpatrolpattpatternpaulpaulidespawspayingpb010036pb010084pb010186pb040001pb050063pb105pbd-1300apc45pcbapcvg-1pd366bspe050156peacepeachpeakpeak1peaveypedalpedestalpeeppefectionpelcopelicanpellpelletpelletspelletstovepelletstovemasterpelletventpelpropeltpencilpendantpendingpendletonpeninsularpennpennsylvaniapensilpentaxpenthousepeoplepepinpepperpercentpercolatorperfectperfectaperfectflowperfectionperformanceperformerperformingperiodperkinsperrypersimmonpersonpersonalpersonalizedpetrolpf100pf2epfk-400pfk-400spg26ph-123ph-ccw1hph50cabpsph50psphasephazephevphilcophillipsphoenixphonephotophotoelectricphotographsphotospi40piazzettapickpick-uppickerpickuppickupspicnicpicspicturepicturespiecpiecepieceheavysorrypiecespiercedpiespiezopillarpilotpinepinionpinkpintpioneerpipepipe-adjustablepipe-stainlesspipespipettepipingpiquapistolpitchpitchedpitspittpittsburgpittsburghpittsfordpittstonpizzapizzadomepizzelplaceplacementplanplanetplanningplansplantplaqueplasticplataplateplatedplateretailplatesplatinumplatoonplayplayboysplayerplayoffsplaysetplaythingspld617rtisspleasantpleasepledgeplexplisploogplowplugpm10hpm600ssvpneumaticpocketpodiumpointpointerpokemonpolandpolarispolarizedpolepolicepolishpolishedpollypolyfiberpondpoolpop-uppoplarpopularityporcelainporchporkportport-a-kitchenportableportatilportionportlandportoportraitspositectorpositionpossiblepossiblypostpost-warpostalpostcardsposter-postspotatopotbelliedpotbellypotensicpotentialpotspottstownpouchpoundspouringpowderpowderedpowerpoweredpowerfulpowerheatpowerhousepowerpackpowerspowerstrokepp130pp2011pp2564pp2576pp2577pp2584pp2700pp4010pprwkpr-2pr-82pr-8vpracticalpracticeprairieprattprc-25prc-77prc9864prd364jdguprd606rcgprd606rcsgpre-cutpre-ownedpre-seasonedprebuiltprecisionprecursorprecutpredatorprefabpreheatpremierpremiumprentissprentiss-waberspreownedpreppreparepreparedpreparednesspreparesprepperprepperspreppingprepsprescottpresentspreservingpresidentpressespressureprestigeprestopretendprettyprevailpreviapreviewprewarprewayprg366jgprh9230sspricepricedpricesprimitiveprimusprinceprincessprinciplesprintprintingpriorprizeprizerprizmprl366egpro-lrpro-stylepro24g-stpro36g-copro36g-stpro60g-stprobeproblemproblemsprocedureprocessprocessingprocessorprocomprodproductproductionproductionsproductsprofessionalprofileprog-statprogrammableprojectpromasterpromotionalprongsproofprooneproppropanpropanepropanenaturalpropanopropelproperprosprosperityprotectprotectionproteinprotektorprotoprotocolprototypeprovidesproximityps3494755ps35ps40ps438990psakipsigpt-r24pu-047040pu-076002bpu-4c447pu047040pullerpulleypullmanpulppulsepulsefirepumppumpkinpuppypurchasepurchasedpurepuritanpurplepurposepushpushingputinputspw-1-45pw-45pw100pxv16pyramidpyrexpyropyromidq3xtbld200-q8qnsd250t-rquadquadraquadra-firequadrafirequailqualifiedqualityquantarquantityquartquartzqueenquemadorquemadoresquennslandquestquickquick-litequicklyquietquieterquietestquiltquiltedquincyquonsetr-dynamicr10106r120a-6r14005r364cr90era003ra003bra003rra46ra48rabbirabbitraceracerracingrackracksraconradarradialradianceradiantradiantfireradiationradiatorradioradiusraemcoraftragingraiderrailrailroadrailsrailwayrainrainbowrainierraininraisedrakietowyrallyramblerranchrancherrangerange-blackrange-hearingrange-roverrange-stoverange-tecrange-vipersrange1000range14mirange18rangebsrrangecooktoprangefrangefinderrangelightlyrangeovenrangerrangesrangestoverangestoveovenrangetacticalrangetoprangetterapidrapidsraptarrarerarecolemanraritirascalratchetrateratedratelcorathbonerationrationsraveravellirawhideraymondrazorbackrb-25rbe-97nrc120rc8900xxwrc8950xrh2rck-irck-krcm-24rcs366bv2rdipr101rssre-conditionedre-platedre-purposedre9000reachingreactorreadreaderreadingreadyready-selectrealrealistrealisticreallyrearreardonreasonablerebelrebuildrebuiltrebuilttestedreburningrecdonditionedreceiptreceiverrecentlyreceptaclerechargerecipereclaimedreclaimerreconreconditionedreconditionedtestedrecordrecordsrectangularredcliffredfieldredoredonereducereducerreelreenactmentreferencerefillrefillablerefinishedreflectorrefoamrefractoryrefreshedrefridgeratorrefrigrefrigeratingrefrigeratorrefurbrefurbishrefurbishedregainregalregattaregencyreginaregionalregionalismregularregulatedregulationsregulatorreissuerelayreleasereleasesreliablereliancereliantrelicreliefreloadedreloadingremanremanufacturedremcoremingtonremoremoteremovableremovedremoverrenaissancerenegaderenkusrenownrepaintedrepairrepairedrepeaterreplacereplacementreplacementbrandreplacesreplacingreplacmentreplicareportreporterrepositionreprintreproductionreproductionsrepublicrepublicanresearchreseasonedreservereservoirresetresidentialresidualresistresistanceresoluteresolutionrestrestartrestaurantrestorationrestorerestoredrestoredisplayrestoringrestrikeresultsretailretardentreticleretreatretroreturnsreveal-xr30revealedrevealsreversiblereviewreviewedreviewsreviewusrevillusionrevisitedrevitalizerevlonrevolutionrevolutionaryrexuavreznorrheemrhoderhรดneribbonribsrichrichlandriddlerrideridersridgerifleriflescoperightrigidrikarileyrimlessrimsringringsrinkerriotsriseriserriterivalriverriversrk-1rlodrm-1roadroadshowroadsterroastroasterrobertshawrobinrobotrobotsrobyrochesterrockrockerrocketrockfordrocksrockyroebuckrogerrogersrollrollerrollingrolloutromaromeromicronroofroomroomsroperoperroserossrotaryrotatingrotisserieroughoutroundsroverroverlandroverrangeroyalroyalerpg50bmgrr-6rs-96crs-96srs67rs7400rsd30srsdb-06rt-abaxrtg-24rubberruggedrulingrunawayrunningrunsrussiarussianrussiansrussorustrustedrusticrustyrutlandrv-35rvch336ssrvru3rvyachtrws-424174mhrx-1rx-2800rx-cs7ryans-15s-2-bs-300s-6-26s-types08e03s120s30vs31105s36ds4361bxrlzs60dds60dd-2gs9529sa-beta-12ltasab08sacksaddlesafarisafesafescansafetysaharasailsailboatsailingsaladsalamandersalatinsalesalessalesmansalesman'ssalesmensalesmenssaltsalvagesamesamedayshipsamplesamplessamsungsanctionssandsandssandwichsandwichessanitizingsanitizorsantasantafesantorinisapisapphiresardsardashtsardinesarsasattlersattlerssaucesaucepotsauersaunasavagesavannahsavesaversavingsawdustsawtoothsawyersaxophonesayssb55scaldscalescamscannerscarcescarletrangescaryscatteredsccmscenescentschlueterschoolschraderschrockschweikertsciencescientificsconcescooterscopescope4x12x40scorchedscorescottscoutscoutsscratchscreenscrewscrewdriverscrewssculpturesd9088se4850se630se630fp4seahorsesealsealedsealerseallinesealsseamlesssearchsearingsearsseasideseasonseasonedseasonsseaswingseatseatedseawardsecondsecondarysecondssecretsectionalsectionssectorsecuritysedgwickseedseeingseekseensegwayselectselfself-cleanselkirksellsellersellingsellsselmersemisemi-customsemiquincentennialsenatorssendingsennheisersensi-tempsensitivesensorsentryseptseptembersepuraserefina-naturalserenityserialseriesseriousserparserrationsserviceserviceableservicedset-set-upsethsetrasettingsettingssetupsevenseveresevillesf-250sfb-600dsg15sh25shabbyshadrachshaftshaftsshagshakershakersshakingshallowshampooshangri-lashankshannonshapesharedsharpsharpsshashlykshastasheathshedsheepsheepherdersheeshsheetsheetssheffieldsheilashelburneshelfshelf6shellsheltershelvesshepe-rwshieldshiftshiftershiningshipshipmateshippedshippinshippingshipsshoafshockshockingshocksshoesshootingshopshopsshortshortageshortagesshortsshotshotgunshottshouldshouldnshovelshowshowershowersshowingshp-10-rwshp-12-1shp-24-4shp-48-8shpepi-rwshredlghtsshroudshtfshutdownshutoffsi-3296lsibleysideside-windersidedsidewindersidewinderpotsieglersiemenssierrasigg-touristsightsignsignalsignaturesignedsilencercosilentsilhouettesilicasilksilnylonsilversilveradosilverfiresilverwaresimplesimplictysimpsonsimulatorsinglesingle-burnersingle-outputsinksislersitesitssizesizedsizesskateboardskeetskeletonizedskewerskilletskilletsskinnerskinnyskobacskogmoskooliesky-1001-asky-1001th-asky-3301sky-5301skyrocketsskytechskywokersl-w-cr-10kslatesleepsleepersleeveslideslide-inslidingslightlyslimslip-insliverslugsm-181csm-181c-tsm-351c-fsm-351c-ftsm1000sm181rsmallsmartsmeltingsmithsmokesmokelesssmokersmoothsnailsnapsnaresnipersnorkelsnoutsnowsnowboardsnowbreakersnowfallsnowflakessnowstormsnugpaksoapsoapstonesoaringsodiumsogharisoildsok31001solarsoldsolderingsoldiersoldierssolenoidsolidsolosolussolutionsolutionssolvedsomesonicsonorasonssoonsootsotosoulsoundsoundingsoundtracksoupsourcesouthsouthbendsouthernsp01sp12sp12bsp2000pssp2047sp22sp24sp2700sp4000spacespacersspansparesparessparkspatialspc4000spc50spdtspeaspeakerspeakersspeakers-truespeaksspearspecspecialspecificationsspectrophotometerspeedspeederspeedloadersspeedmasterspeedrangespeedsspeedyspendingspg1spg9000spg90bspicespiderspider-manspillospinnakerspinnerspinningspiritspiritsoulsplashsplinesplitsplitterspoilerspokanespool-sporstersportsporteesportmastersportssportsersportsmansportsman'ssportsterspotspot-onspotlightspotterspottingspoutsprayspringspringssprocketspusm-261csqftsquadsquaresquirrelsr-2g12sr-4sr001sr57esrh3500srt486gsrv480-s430-ampsrv7000-194srv7000-205srv7000-206srv7000-704srv7001-038srv7033-023srv7034-072bsrv7038-118srv7039-004srv7077-051ss950-24000ssbon-20ssiisssniperwolfst20575d14st22575r15st436exrlzstabilitystablestackstackedstagestainedstainlessstalkingstampedstampingstanstandstandardstandardsstandingstanleystansportstarstarkeystarrettstartstartedstarterstartingstartupstatstatestatesstationstaystaytonstc8027stcroixsteakstealthsteamsteamersteampunksteelsteelcatsteelesteelesssteepsteeringstemstepstephenssteppingstepsstereostereoscopicsterilizationsterilizersterlingsternsternostetsonstevenstevensstewartstibnitestickstickersstillstingerstirstocdstockstockingstockpilestocktonstocky'sstokestokerstonestopstoppedstoragestorestoriesstormstorystoutstovestove'freestove-antiquestove-cm1945-aladdin-1945-wrench-casestove-coppertonestove-epastove-greystove-kettlestove-largestove-namedstove-nostove-rarestove-refurbstove-savestove-sunshinestove-topstove18stove22stovecooker-20stoveferrostovefirestovefireplace1970-72iconicstovefurnacestoveheaterstoveheaterlampstoveincstoveinsertstovelampstoveovenstoveovenrangestovepipestoverstoverangestoverefridgeratorstovesstoves-archstovetopstoveunusedstoveusscstoveworksstratstratolinerstratusstreetstrikesstroudstructurestrutstrutmastersstrutsstudiostudystuffstunningstylestylingstylishsubmersiblesubseasuburbansuccesssugarsuitsuitcasesumfiresummarysummersummerssummitsundancesundownsunflowersunglasssunglassessunglosunnensunnysunraysunroofsunshinesupersuper-12superbsuperchargedsuperchargersuperevacsuperherosuperiorsuperventsuppsuppliessupplysupportsupposedsuppressionsupremesuresure-tempsurefiresurfacesurfacessurfersurgicalsurplussurroundsurveillancesurveysurvivalsurvivalistsurvive-survivingsurvivorstillsuspensionsusquehannasuzysv10sve47600wsveasw2100sw3100sw740sw940swampswarmsswartzbaughswayswc21bswc21mswc21rswedensweetsweetwaterswimswimmerswimmersapiswimmingswimsapiswingswirlsswissswitchswitchedswivelsynchronizedsyntheticsyracusesyrahsystemsystemssystemti-trit-7frt-lft-postt-shirtt1118t58-2t6354tabltabletablestabletoptabstacktacotacomatacticaltaggedtagstahoetailgatetailgatingtaillighttailortaketakentakestakingtalestalktalk-ustalkietalkingtalltamaracktandytangtanktankstannedtantotapetapeslotstappantappingtar-6taranistargettargetstargettacticaltaurustaxidermytaykittaylortaylormadetbrwteakteamteapotteautechtechnologiestechnologytecsisteepeeteletelecasterteleflextelescopetelescopictelescopingtelltellstemptempcotemperaturetemperedtempeturetempstenmiletenntennesseetennistentteraflextermterminalterminationterrifiesterritoryterryteslatesorotesorostesttestedtested-workstestertestimonialstestingtetectexastexturedthankstharringtontheaterthelintherethermtherma-tekthermadorthermadorboschthermalthermothermo-corethermodiscthermoelectricthermometerthermosthermostatthermostaticthermowellthermoworksthetr002bthgisthickthimblethinthingthingsthinkingthinlinethomasthompsonthorthreadthreadedthreatthreethree-burnerthree-speedthrough-the-ceilingthrough-wallthrowerthrowflamethruthru-the-wallthruhikethugthumbthunderthunderclapthursdaytiburontickettidewatertieasytiedownstigertighttikestiletimbertimberlinetimberridgetimberwolftimetimertimerthermostattimingtinnerstinsparestinttinytinyhouseoffgridtipitippmanntipstiretirestitantitaniumtitletjernlundtl200tlc-200tm8-615tmd60-24rgb-2newtmhx2450-c-3000004tmoatoastertoastytodaytoddlertoletoledotolltombstonetommytommybitestvtomounttonstonytooltoolstop-of-stovetopcoattopelectrictoppertoppingtopreviewstopstorchtorklifttorntornadotorontotorquetorrtouchtouchpadtourtowertowntoyotatoystps35tr001tr004tr007tr009tr22tractraceabletracktrackingtractortradetrade-windtrademarktraditionaltraegertrailtrailertrailortraintrainingtrangiatransceivertransducertransformertransmissiontransmittertraptrapezoideltrapperstrashtrav'lertraveltravelertraversetravistraytraystreasuretreatmenttreetreestrekkertrenttri-bandtri-jettri-plytri-wingtriaxtriaxialtribetributetricktrickstriedtriggertrijicontrimtrimestretriptripletriple-curvedtriple-plytriple-walltriple3trippingtrivettrixtrogtrooptroopstrophytroubletrouserstroytru-hybridtru-sonictrucktruckertruetruglotruloktrumptrunktrusonictruthtsp02081tstattubetubestubulartucsontullamoretulleytundratunertuningturboturbochefturbodriveturfturnturnbuckleturnedturnerturningturnsturquoiseturquoiseaquatuscanytutorialtuxedotv7israeltvdr3604bawtvdr4806bdbtweetertweeterstwelvetwilighttwintwisttwist-locktwo-burnertwo-waytx-dtypetypestytronicsu0026u0026au6-lr-usu63b1uap-ac-lruberlebenubiquitiufc-1661uglyuhfvhfuimco2217300ukraineul-1482ultimateultraultralightultramaticumcoumpireun-firedun-paintedunableunaffordableunbeatableunboxinguncoveredunder-cabinetunder-seatundergroundunderhoodunderwaterunexpectedunfiredunfired-colemanunfirednewithmintyunforgettableunidenunifiunionuniquniqueunisonunitunitedunitfieldunivuniversalunknownunleadedunlimitedunmodifiedunopenedunpackingunpaintedunreasonableunrestunrestoredunsureuntesteduntested37unthinkableunusedunusednewunusedunfiredunusualunveilsup-closeupdateupgradeupgradedupgradesupheavaluplandupperuprighturbanurbanaurgentus-nous1100eus1269eus2000eus89us89-aus89-pusb-cusccusdausedusedrefurbishedusefulusesusg350usgiusingusmcusmdusmilitaryuspsausscussc-1600ef-unitedussc-4840-unitedusstoveut-aaautensilsutilityuv-visuv10ruv5ruv9rv-seriesv260v9000vacuvacuuvacuumvad10001vad10004vad8402vadervadm2vainvalleyvaluevalvevanagonvanishedvanlifevantagevaporvaporevaporizervarivari-xvariablevariesvarietyvarmintvaughnvavavcdsvdsc485-6gssvectorvegetablevegetablesvehiclevehiclesvelarvelocityvenancioventvent-a-hoodvent-freeventedventilatingventilationventilatorventingventisventlessventsaverventurivenusvermillionverminvermontverniervernonveronaversaversatileversaventversionversusverticalveryverygood-vestvestavestalvevorvg130vg150vg5770vg5790vg820evg900vgcc5484gqssvgicvgic53024bssvgis480-6gdssvgr73614gssvgrc605-6gqdssvgucvibrationvicevictorianvideovietnamviewviewsvigilantviiiviintagevikingvillagevinalvindexvinidavintaevintagevintage'soapvintageantiquevintangevinylviolencevirginiaviscosityvisevisiblevisimindervisionvisitsvisualvisualitevitgvitrovitrockvivicreatevkpc020009vlogvmpsvntgvocabularyvogelzangvoicevolcanovolcanosvolgalzangvollrathvoltvoltagevolumesvortexvplwc0061vplww0078vplyb0355vprovr-4vr4srvsl400vsl4303rcvsl4363rcvsl436bfvsl442-0-22bfvsl4426rcvsl4486rcvt8-fvulcanvx-2vx-3vx-3ivx-iivx-iiiw-ignitorw-keyw10162037w10173523w10207928w10223231w10245805w10331686w10536300w10651914w10651915w10717749w10823719w10823727w10860916w11113908w11122551w11258611w11351717w11394363w11511589w11536412w11764616w3100iwaberwaberswadecowadeowadrowaferwafflewahlwaistwaitwalkwalkerwalkiewalkthroughwallwall-mountwall-mountedwallaswalmartwalnutwalruswantwantswardwardswarewarehousewarhornwarmwarmedwarmerwarmingwarmswarmthwarnewarnedwarnerwarningwarnock-herseywarrantywarswarwwiiwashwasherwashingwashingtonwatchwatchingwatchmanwaterwaterproofwattwatterswattswavelengthwaynewaynesborowayswb21x38549wb21x5322wb27x25346wb27x33125wb36t10545wb44x10010wb49t10037wb56x26696wb62t10026wb62t10752weaponweaponsweatherweatheredweathertechwebsterweddingwedding-anniversarywedgewedgewoodweedweedenweekweekendweeklyweg745h0fswehrleweighsweightweirwelcomewelcomesweldweldedwelderweldingweldmentwellwellswenglorwerewestwesternwestfaliawestinghousewestlakewfb11wfe320m0jw4whalewhaleman'swharfdalewhdrwheelwheelingwheelswhirlpoowhirlpoolwhiskeywhisperlitewhistlewhistlingwhitewhiteblackwhiteduckwhitfieldwholewholesalewi-fiwichitawickwicklesswidewide-rangewidefieldwifewifiwiggy'swilcoxwildwildernesswildflowerwildlifewilliamwilliamswinchwinchesterwincroftwindwindagewindburnerwindowindowwindproofwindscreenwindscreensidewindshieldwindsorwindtamerwinewingswinnerwellwinrichwinslowwinsorwinterwirewirelesswiringwisconsinwisdomwisewiselywisewaywishwithwith1080pwith16with6withaccessorieswithaccessoryswithaccswithadhesivewithairwithalumwithaluminwithaluminumwithblowerwithbottomlinewithboxwithcanisterwithcapwithcasewithchimneywithchinstrapwithchromewithconvectionwithcordwithcounterwithdoorwithelectronicwithextendedwithextrawithfirewithfireplacewithfluewithfreewithfrywithfuelwithglasswithgpswithgriddlewithgrillwithgrnwithhearthwithheaterwithhemmedwithhingedwithholewithinfraredwithinstructionwithledswithlidwithlidboxpaperswithmutewithnewwithowithobwithohcwithoptarwithorigwithoriginalwithoutwithovenwithpipedamperwithporcelainwithprizmwithpyrexwithrangewithrarewithreal-timewithspareswithstainlesswithstoragewithstovewithtankwithtubeswithwhizzerswithwoodwittekwjafwm298wod51ec0hswolfwollwolverinewomenwomenswonderwondercoalwonderluxwonderluxewonderwoodwoodwood-burningwood-coalwood-stoveheaterwoodbinewoodburnerwoodburningwoodburningstovewoodcoalwoodcolwoodenwoodezewoodlandwoodlanderwoodprowoodswoodsmanwoodstockwoodstovewoodstoveswooferwooferswoolwordworkworkedworkhorseworkingworking-napoleonworkngworkoutworksworks-pelletworks-pre-ownedworkshopworldworld'sworldwidewornworriedworsewouldnwp-2wp73001165wp74005745wp7502p382-60wp8285937wpw10177195wpw10204680wpw10207928wpw10278150wpw10409945wpw10476353wpw10556710wranglerwrapwrenchwringerwristwrongwroughtwrtyws4920hewtolwurlitzerww11wwiiwyomingwyottwyott1974x-180x-casex-iiix-sightx15tallxceedid-lenelxclntxenonxeroxf2100-bxfmrxgk-exxiiixl18xp7000xp7320xqc500030xqk500060xtraxtrasxtrordinairxxiiiy04100260yachtyahmoniteyardyearyearsyellowyellowstoneyk60lwyodayokeyorkyoungyoutubeypsilantiyugoslaviayukonyurtywc000922ywc106760ywj500130ywj500170z-flexz-linezebrazenithzephyrzerozestzetexzeuszfswa2-63drzinczlinezodi

Categories

Flickr Photogallery

Subscribe Newsletter

subscribe with FeedBurner

Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED

  • January 8, 2021 at 5:09 am
Early_BSR_Birmingham_Stove_Range_12_Cast_Iron_Skillet_Cleaned_and_RESTORED_01_awjk
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED

Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED
BSR Birmingham Stove Range #12 Cast Iron Skillet. Cleaned and RESTORED – Red Mountain series – Condition is used. A cast iron skillet that’s big enough for holiday cooking. This skillet was manufactured by Birmingham Stove and Range (BSR) in Birmingham, Alabama, probably sometime in the 1930s1940s. Marked on the bottom. RESTORATION: This pan was stripped to bare metal with lye and electrolysis (see last photo). Lye efficiently removes all organic matter including baked on carbon, food remnants, baked on grease, and anything else caked on the metal. This takes anywhere from a few hours in the lye solution to several weeks for especially tough pans. Electrolysis removes everything else using electrical current to separate rust, carbon, and anything the lye has left behind. Time spent in electrolysis is vastly reduced by treating pieces in lye first, so the average pan spends 48 hours in the electrolysis tank. The end result of this process is the elimination of any residue that has accumulated on the pan, ensuring that you start with a completely clean cooking surface. It was then scrubbed with steel scouring pads, steel wool, “magic” erasers, and a lot of elbow grease. It was seasoned with four layers of a blend of palm oil, soybean oil, grapeseed oil, flaxseed oil, and beeswax (all ingredients are non-GMO) polymerized to the iron at 500ยบ for 90 minutes each. This gives your cookware a durable “non-stick” surface that is dry and displays beautifully. It is ready to use as soon as you unpack it and give it a brief rinse, and a little soap won’t hurt it. CONDITION: This pan is in excellent used condition, with no cracks, warping, or repairs that I can see. The cooking surface isn’t smoothly ground, but is a finely-textured pebbly finish that’s ideal for holding seasoning. This texture takes seasoning incredibly well, and you can expect that over time the rough texture of the cooking surface will gradually fill in and become much smoother as you season the pan with your own cooking. There’s one area on the rim at 8:00 that’s either pitted or a favorite place for a previous owner to smack something hard. It won’t bother your cooking. There’s a scuff on the outside wall you will see in the photos. The pan seasoned to a rich, dark black, and it will continue to get darker as you use it. The skillet has a small wobble corrected by 1 business card, and it will not spin. Make sure to enlarge the photos and have a close look at what you will be getting. MEASUREMENTS: This skillet measures approximately 13. Deep and weighs 7 lb. These large Red Mountain skillets don’t come up that often, and this one will serve you and your family for many years to come. It’s a real workhorse in the kitchen. Your piece will be packed securely with bubble wrap, pool noodles, and anything else needed to keep it secure and stable on its way to you. Please zoom and check photos closely, they are part of description. Item in photos is the one you will receive. No international orders pleaseships only to U. No returnsno warrantee expressed or implied. ABOUT: I’ve been cooking in cast iron for most of my life, and rarely use other pans except for a big stock pot. Vintage cast iron has such a rich history in American industry and innovation it gives so much more to the cook than just a pan to cook in. Some people don’t care about how old a pan is, but the real difference is in the iron itself. Vintage pans are smoother, lighter, easier to move around your stove, easier to clean, and generally very satisfying because of the high level of craftsmanship embodied in the pans, since there was always a lot of handwork involved in their production. The “golden age” of cast ironaround the turn of the 20th century and into the 1930sleft us cast iron. Whether I’m searching out pieces, evaluating them, cleaning, scrubbing, oiling, or packing, I’m always keeping you, the end user, in mind. To protect the iron, bring it back as close as possible to beautiful condition, to make sure it gets to you safe and soundthese are my concerns throughout the process. What can you expect? Super nice piece, great packaging!!! In absolutely fantastic condition!! It’s beautifully seasoned. Thanks so much for a wonderful oven. A pleasure to do business with. Happy I bought it. What a fine pan. Hope to deal with you again. I look forward to providing you with the exact piece you need for your cooking or collecting. And thanks for your interest! The item “Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED” is in sale since Sunday, January 3, 2021. This item is in the category “Collectibles\Kitchen & Home\Kitchenware\Cookware\Cast Iron”. The seller is “jfbookman” and is located in San Rafael, California. This item can be shipped to United States.
  • Modified Item: No
  • Country/Region of Manufacture: United States
  • Material: Cast Iron
  • Brand: BSR

Early BSR Birmingham Stove Range #12 Cast Iron Skillet Cleaned and RESTORED